Lyophilization comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Once reconstituted, a peptide solution is generally less stable than the dry powder. Hydrolysis, oxidation, aggregation, and microbial growth can change the preparation over time, so storage temperature and duration are practical concerns. Dividing a solution into single-use aliquots before freezing can reduce repeated freeze-thaw cycles, which may otherwise cause precipitation or loss of activity. The optimal storage conditions vary by peptide, and no single rule applies to all sequences. Records of solvent, concentration, date, and storage history help maintain traceability. Studies often report stability under defined conditions rather than universal shelf lives.
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Solvent selection depends on the peptide's charge, hydrophobicity, and intended application. Many lyophilized peptides dissolve readily in water, while others require a small amount of a miscible organic solvent, a dilute acid, or a dilute base before aqueous dilution. A buffer may be used when a stable pH range is known, but adding buffer salts can also promote aggregation or precipitation. Dissolution should be observed rather than assumed, because a clear solution does not prove that the peptide is monomeric or fully active. The order of solvent addition and the final volume matter for achieving the intended concentration.
During reconstitution, liquid is directed toward the wall of the vial rather than forcefully onto the powder. Gentle swirling or inversion mixes the contents without creating excessive foam or shear. Foaming can denature some peptides and can make volume measurement difficult. Complete dissolution is often confirmed by visual inspection against a light source. Particles, cloudiness, or undissolved material may indicate incomplete mixing, aggregation, or a solubility limitation that requires further investigation.
Peptide reconstitution is the addition of a liquid to a dried peptide preparation so that the peptide dissolves and forms a solution. Many research peptides are supplied as lyophilized powders, a form produced by freezing and then removing solvent under vacuum. The dried material often appears as a cake or fluffy powder. Dissolution depends on the peptide's sequence, charge, and hydrophobicity. Not all peptides dissolve equally in the same liquid.
The choice of solvent is guided by peptide properties and the intended downstream use. Water alone can dissolve many hydrophilic peptides, while hydrophobic sequences may require a small amount of an organic solvent or a buffered solution. Some peptides carry net charges that affect solubility across pH values. The pH of the final solution can influence stability and aggregation. In research settings, the solvent is selected to match the assay or analytical method rather than for any therapeutic purpose.
| Property | Value | Notes |
|---|---|---|
| Physical state before reconstitution | Lyophilized powder or cake | Appearance varies from fluffy to compact; not a solution. |
| Common solvent | Sterile or ultrapure water | Many peptides dissolve, but solubility is sequence-dependent. |
| Alternative solvent | Dilute acetic acid or acetonitrile/water | Used for hydrophobic or basic peptides; compatibility varies. |
| Typical storage after reconstitution | 2–8 °C short term; −20 °C or below for aliquots | Stability is peptide-specific; avoid repeated freeze-thaw. |
| Common analytical method | Reverse-phase HPLC | Assesses purity and concentration; mass spectrometry confirms identity. |
Quality control of reconstituted peptides combines visual inspection with instrumental analysis. A clear solution does not prove correct identity or purity, and a cloudy solution does not always indicate failure. Reverse-phase high-performance liquid chromatography can separate the peptide from related impurities, while mass spectrometry confirms molecular mass and detects modifications. pH measurement and osmolality checks provide additional information about the solution environment, and documentation of lot number, solvent, and storage history supports traceability.
After a peptide is reconstituted, handling practices affect its chemical and physical stability over time. Aqueous solutions can support microbial growth unless they are prepared with aseptic technique or contain preservatives. Container material matters because peptides can adsorb to glass or plastic surfaces, reducing the amount available in solution. Repeated transfers increase exposure to air and potential contaminants, and temperature fluctuations can accelerate degradation. These factors are separate from the peptide's intrinsic sequence-based stability.
Storage conditions for reconstituted peptides are product-specific. Cool temperatures slow many degradation pathways, but freezing can concentrate solutes and promote aggregation. Light exposure can oxidize susceptible residues such as methionine, cysteine, or tryptophan. Oxygen in headspace can contribute to oxidation, while acidic or basic pH can drive hydrolysis and deamidation. The best storage condition for a given sequence is often determined empirically because general rules do not capture all sequence-specific effects.
Solvent choice depends on peptide polarity and intended use. Many peptides dissolve in water or buffered aqueous solutions, while hydrophobic sequences may need a small amount of organic solvent such as acetonitrile or dimethyl sulfoxide before aqueous dilution. The solvent should match the downstream analytical method and not interfere with detection. Gentle mixing or brief sonication can help, but vigorous agitation may promote foaming or aggregation. Complete dissolution is judged by a clear liquid free of visible particles, though some turbidity can persist.
Reconstitution concentration is chosen from the mass of peptide and the volume of solvent added. Researchers often prepare a concentrated stock and then divide it into single-use aliquots to reduce freeze-thaw cycling. The actual peptide content may differ from label mass because of counterions, water, or impurities. For that reason, quantitative work may require independent measurement such as amino acid analysis or ultraviolet absorbance. Records of solvent, volume, date, and lot help trace later observations.
Lyophilized peptides are supplied as dry powders or porous cakes that remain stable during shipment and short-term storage. Reconstitution is the laboratory step of adding a suitable solvent so the solid dissolves into a liquid stock. The dried state limits hydrolysis and microbial growth, but it does not remove all residual water or salts. Sequence, counterion, and manufacturing method influence how quickly and completely a peptide enters solution. Researchers treat reconstitution as a practical starting point for later dilution, analysis, or assay work.
Microbial contamination is a concern for aqueous peptide solutions, especially those without preservatives. Bacteriostatic water contains an antimicrobial preservative and is used in some laboratory settings, while sterile water lacks preservatives. Filtration through a sterile filter can reduce particulates and microbes, but some peptides adsorb to filter membranes. The effect of preservatives on peptide stability is peptide-dependent and not fully predictable. Documentation of lot number, solvent, date, and storage conditions supports traceability and reproducibility.
After reconstitution, peptide solutions are generally less stable than lyophilized powders, and hydrolysis, oxidation, deamidation, and aggregation can occur in solution. Stability depends on peptide sequence, concentration, pH, buffer composition, temperature, light exposure, and dissolved oxygen. Many research protocols store reconstituted solutions at 4 °C for short periods or at -20 °C or -80 °C for longer periods. Repeated freeze-thaw cycles can promote aggregation and loss of activity. The optimal storage condition is peptide-specific and often determined empirically rather than predicted from sequence alone.
=== MALDI-TOF === The same research group that developed COLD-PCR and used it to compare the sensitivity of regular PCR for genotyping with direct Sanger sequencing, RFLP, and pyrosequencing, also ran a similar study using MALDI-TOF as a downstream application for detecting mutations. Their results indicated that COLD-PCR could enrich mutation sequences from a mixture of DNA by 10–100 fold and that mutations with an initial prevalence of 0.1–0.5% would be detectable. Compared to the 5–10% low-level detection rate expected with traditional PCR.
On September 29, 2025, President Trump announced, alongside Prime Minister Netanyahu, a 20-Point Gaza Peace Plan from the White House which consisted of 20 specific points aimed at achieving a ceasefire, the return of Israeli hostages, dismantling Hamas's military capabilities, and establishing a transitional governance structure in the Gaza Strip. In October 2025, President Trump announced his deal for a ceasefire between Israel and Hamas had been reached and that the remaining hostages would be released. In exchange, Israel will release 250 Palestinian prisoners serving longterm sentences and another 1,700 other prisoners. The Israeli military will withdraw from a "blue line" to a "yellow line" further away from the Gaza coast. Trump was widely praised for negotiating this settlement, including by former presidents Bill Clinton and Barack Obama and former Secretary of State and 2016 presidential candidate Hillary Clinton.
There were concerns in the 2000s about the sugar and vitamin content of Ribena, a blackcurrant-based syrup and soft drink owned by GSK until 2013. Produced in England by H.W. Carter & Co from the 1930s, the company's unbranded syrup was distributed to children as a source of vitamin C during World War II, which gave the drink a reputation as good for health. Beecham bought H. W. Carter in 1955. In 2001, the British Advertising Standards Authority (ASA) required GSK to withdraw its claim that Ribena Toothkind, a lower-sugar variety, did not encourage tooth decay. A company poster showed bottles of Toothkind in place of the bristles on a toothbrush. The ASA's ruling was upheld by the High Court. In 2007, GSK was fined US$217,000 in New Zealand over its claim that ready-to-drink Ribena contained high levels of vitamin C, after two schoolgirls showed it contained no detectable vitamin C. In 2013, GSK sold Ribena and another drink, Lucozade, to the Japanese multinational Suntory for £1.35 billion.
Aerosol mass spectrometry has also found its way into the field of pharmaceutical aerosol analysis, due to its ability to provide real-time measurements of particle size and chemical composition. People who suffer from chronic respiratory disease commonly receive their medication through the use of either pressurized metered dose inhaler (pMDI) or dry powder inhaler (DPI). In both methods the drug is delivered directly into the lungs by inhalation. In recent years, inhaled products have become available which deliver two types of drug within a single dose. Research has shown that the two drugs inhalers provide an enhanced clinical effect beyond that achieved when the two drugs are administered concurrently from two separate inhalers. It was determined using an AToFMS that the respirable particles in a DPI product and pMDI product were composed of co-associated active pharmaceutical ingredients, which is the reason behind the increased effects of the two drug inhalers.
== History == SDA was first mentioned in the scientific literature by 2013, but was only conceptually described at this time. Subsequently, its synthesis and preclinical pharmacology were described by Nina Kastner and colleagues including Matthias Grill at MiHKAL in 2025. Prodrugs of SDA and/or related compounds have also been described.
Sources: en.wikipedia.org
The list contains recommendations for 523 medications. A separate list for children up to twelve years of age, known as the WHO Model List of Essential Medicines for Children (EMLc), was created in 2007, and is in its 10th edition. It was created to make sure that the needs of children were systematically considered such as availability of proper formulations. Everything in the children's list is also included in the main list. The list and notes are based on the 19th to 24th edition of the main list. Therapeutic alternatives with similar clinical performance are listed for some medicines and they may be considered for national essential medicines lists. The 10th Essential Medicines List for Children was updated in September 2025. Note: An α indicates a medicine is on the complementary list.
=== Autosamplers === Large numbers of samples can be automatically injected onto an HPLC system, by the use of HPLC autosamplers. In addition, HPLC autosamplers have an injection volume and technique which is exactly the same for each injection, consequently they provide a high degree of injection volume precision. It is possible to enable sample stirring within the sampling-chamber, thus promoting homogeneity.
== Function == In eubacteria, there are three groups of factors that promote protein synthesis: initiation factors, elongation factors and termination factors. The elongation phase of translation is promoted by three universal elongation factors, EF-Tu, EF-Ts, and EF-G. EF-P was discovered in 1975 by Glick and Ganoza, as a factor that increased the yield of peptide bond formation between initiator fMet-tRNA(fMet) and a mimic of aa-tRNA, puromycin (Pmn). The low yield of product formation in absence of EF-P can be described by the loss of peptidyl-tRNA from the stalled ribosome. Thus, EF-P is not a necessary component of minimal in vitro translation system, however, the absence of EF-P can limit translation rate, increase antibiotic sensitivity, and slow growth. To complete its function, EF-P enters paused ribosomes through the E-site and facilitates peptide bond formation through interactions with the P-site tRNA. EF-P and eIF-5A both are essential for the synthesis of a subset of proteins containing proline stretches in all cells. It has been suggested that after binding of the initiator tRNA to the P/I site, it is correctly positioned to the P site by binding of EF-P to the E site. Additionally, EF-P has been shown to assist in efficient translation of three or more consecutive proline residues.
Octopuses have two sexes and have only one gonad (testis in males and ovary in females) located posteriorly. The gonad deposits gametes into an adjacent cavity called the gonocoel. A gonoduct bridges the gonocoel with the mantle cavity. An optic gland creates hormones that cause the octopus to mature and age and stimulate gamete production. The timing of reproduction and lifespan depends on environmental conditions such as temperature, light and nutrition, which trigger the gland. The male has a specialised arm called a hectocotylus which it uses to transfer spermatophores (packets of sperm) into the female's mantle cavity. The hectocotylus in Octopus is usually the R3 arm, which has a spoon-shaped depression and a suckerless tip. Fertilisation may occur in the mantle cavity or in the surrounding water. Reproduction has been studied in some species. In the giant Pacific octopus, courtship includes changes in skin texture and colour, mostly in the male. The male may cling to the top or side of the female or position himself beside her. There is some speculation that he may first use his hectocotylus to remove any spermatophore or sperm already present in the female. He picks up a spermatophore from his spermatophoric sac with the hectocotylus, inserts it into the female's mantle cavity, and deposits it in the correct location in the opening of the oviduct. Two spermatophores are transferred in this way; these are about one metre (yard) long, and the empty ends may protrude from the female's mantle. A complex hydraulic mechanism releases the sperm from the spermatophore.
=== Support selection === For a support material to be ideal, it must be hydrophilic, inert towards enzymes, biocompatible, microbial attack and compression resistant, and must be affordable. Support materials can be organic or inorganic, synthetic or natural (depending on the composition), since they are biomaterial types at the end. There is no universal type of a support material to be used for the immobilization of all enzymes. However, there are some commonly used supports such as silica-based carriers, acrylic resins, synthetic polymers, active membranes and exchange resins. One of the hardest processes before the immobilization process itself, is the selection of support material since it relies on the enzyme type, reaction of media, safety policy of hydrodynamic and reaction conditions. As different types of support give different physical and chemical characteristics and properties, which would effect enzyme function, such as: Hydrophilicity/hydrophobicity, surface chemistry, and pore size.
Sources: en.wikipedia.org
==== Undernutrition ==== Undernutrition due to lack of adequate breastfeeding is associated with the deaths of an estimated one million children annually. Illegal advertising of breast-milk substitutes contributed to malnutrition and continued three decades after its 1981 prohibition under the WHO International Code of Marketing Breast Milk Substitutes. Maternal malnutrition can also factor into the poor health or death of a baby. Over 800,000 neonatal deaths have occurred because of deficient growth of the fetus in the mother's womb. Deriving too much of one's diet from a single source, such as eating almost exclusively potato, maize or rice, can cause malnutrition. This may either be from a lack of education about proper nutrition, only having access to a single food source, or from poor healthcare access and unhealthy environments. It is not just the total amount of calories that matters but specific nutritional deficiencies such as vitamin A deficiency, iron deficiency or zinc deficiency can also increase risk of death.
The two substrates of this enzyme are (+)-borneol and oxidised nicotinamide adenine dinucleotide (NAD+). Its products are (+)-camphor, reduced NADH, and a proton. This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is (+)-borneol:NAD+ oxidoreductase. This enzyme is also called bicyclic monoterpenol dehydrogenase.
== Early life and career == Cantelmo was a high school valedictorian. He graduated from Yale University with a degree in molecular biophysics and biochemistry. He worked for about 35 years in the pharmaceutical industry, specializing in high-performance liquid chromatography (HPLC). According to his own accounts and those of family members, he ran three HPLC companies. The last of these was GL Sciences. He left that position prior to the events of 2019. GL Sciences has stated it has no association with Cantelmoism or the use of illegal drugs. Cantelmo had a history of mental health difficulties and prior suicide attempts. He had also used other substances, including mescaline, LSD, and methamphetamine, at earlier points in his life.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
Sources: en.wikipedia.org
It means adding liquid to a lyophilized peptide powder so it dissolves into solution. The dry powder is not a finished liquid product, and the resulting concentration depends on the volume added. Complete dissolution should be visually confirmed before use.
Some peptides have hydrophobic regions or strong charge interactions that make water a poor solvent alone. A small amount of organic solvent, acid, or base may be needed before aqueous dilution. The appropriate approach depends on sequence and should be based on documented compatibility.
No. Solutions can degrade through hydrolysis, oxidation, aggregation, and microbial growth, and stability varies widely by peptide. Storage at reduced temperature and avoidance of repeated freeze-thaw cycles are common laboratory practices. Specific shelf lives are determined by stability testing, not by a general rule.
Lyophilized means the material was frozen and then dried under vacuum, leaving a solid powder or cake. The process removes most of the water or solvent. The resulting peptide is typically more stable for storage than a solution.